PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca47256.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 336aa    MW: 37629.3 Da    PI: 8.1339
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca47256.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1652.7e-5161301129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtd+elv++yL  k ++++ +l   + evd++k+ePwdLp+++  + kewyf+s+rd+kyatg r+nrat sgyWkatgkd++v++ +g+ 
  Dca47256.1   6 LPPGFRFHPTDDELVCDYLLLKWNASHSPL---LIEVDLNKCEPWDLPERACIGGKEWYFYSQRDRKYATGLRTNRATVSGYWKATGKDRAVVR-RGNM 100
                 79***********************99888...779************8777899**************************************9.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                 vg++ktLvfy+grapkg+kt+Wvmhe+rle
  Dca47256.1 101 VGMRKTLVFYQGRAPKGHKTQWVMHEFRLE 130
                 ***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-573155IPR003441NAC domain
PROSITE profilePS5100554.8316155IPR003441NAC domain
PfamPF023655.5E-267129IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVEAKLPPGF RFHPTDDELV CDYLLLKWNA SHSPLLIEVD LNKCEPWDLP ERACIGGKEW  60
YFYSQRDRKY ATGLRTNRAT VSGYWKATGK DRAVVRRGNM VGMRKTLVFY QGRAPKGHKT  120
QWVMHEFRLE PPFVPNNLIP SPSKEDWVLC RVFFKSKYGP ARSSSGTENH ERNNNNNNKM  180
IDEVTGSSSV VAMDNYIRFD DTTTTQANAN AYQQVPCFSM FSDNQINRNH NHNNNPTTST  240
SMVFHHNNMM MMMADDNNNN INGLGLGPNG NSKGSPSPGP GPIVACDKKV LQAVLNELTK  300
MEGNAINGSP SIGEAGSSES YLSEVGLQQP SLWSPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-51215611169Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666181.11e-120PREDICTED: NAC domain-containing protein 21/22-like isoform X2
SwissprotQ84TE64e-97NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A151SW561e-120A0A151SW56_CAJCA; NAC domain-containing protein 21/22
STRINGGLYMA15G40510.11e-118(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-91NAC domain containing protein 1